PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G115800.1.p
Common NameSb10g010050, SORBIDRAFT_10g010050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family CO-like
Protein Properties Length: 412aa    MW: 44250.4 Da    PI: 5.2778
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G115800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.21.2e-063375440
              zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                          r C+ +   +   +C+ +  +lC++C +  H        H++v
  Sobic.010G115800.1.p 33 RPCDGCRAAPSVVYCHADAAYLCASCDVRVHAAnrvasrHERV 75
                          67*****************************556677778776 PP

2zf-B_box26.11.8e-0875120342
              zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                            r+C+ +e+ ++ l C+ +   lC  C  + H+       H++vp+
  Sobic.010G115800.1.p  75 VRVCEACERAPAVLACRADAAALCVVCDAQVHSAnplagrHQRVPV 120
                           689*****************************66999999999986 PP

3CCT652.3e-22340383144
                   CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                           Rea++lRYkeK+k+RkF K+irY++RK++Ae RpR+KGrF+k++
  Sobic.010G115800.1.p 340 REARVLRYKEKKKSRKFAKTIRYATRKTYAEARPRIKGRFAKRS 383
                           9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.5E-73077IPR000315B-box-type zinc finger
CDDcd000211.07E-83377No hitNo description
PROSITE profilePS501199.8973577IPR000315B-box-type zinc finger
PROSITE profilePS5011911.10673120IPR000315B-box-type zinc finger
PfamPF006433.8E-775120IPR000315B-box-type zinc finger
CDDcd000212.37E-1076120No hitNo description
SMARTSM003364.8E-1078120IPR000315B-box-type zinc finger
PfamPF062036.2E-17340382IPR010402CCT domain
PROSITE profilePS5101716.122340382IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MNYNFSSNAL DEEEVAGRGG EGGSCAAAPA WARPCDGCRA APSVVYCHAD AAYLCASCDV  60
RVHAANRVAS RHERVRVCEA CERAPAVLAC RADAAALCVV CDAQVHSANP LAGRHQRVPV  120
LPLPVAAIPA ASVLAEAAAT AVAVGDKQEE EVDSWLLLTN TKDPVSDNNN CNCSSSSNNN  180
ISSSNTSTFY ADVDEYFDLV GYNSYCDNHI NSNPKQYGMQ ERQQQQQLLL QKEFGDKEGS  240
EHVVPASQVA MANEQQQSGY GVIGVEQAAS MTAAVSAYTD SITNSISFSS SMEVGIVPDN  300
MATTTDMPNS GILLTPAEAI SLFSSGSSLQ MPLHLTSMDR EARVLRYKEK KKSRKFAKTI  360
RYATRKTYAE ARPRIKGRFA KRSSDMEIEV DQMFSSAALS SDGSYGTVLW F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9736750.0AB973675.1 Miscanthus sacchariflorus MsiHd1 DNA, pseudogene of Constans/Heading date 1, clone: Msa(4x)MsaHd1Non3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436860.10.0hypothetical protein SORBIDRAFT_10g010050
SwissprotQ9FDX81e-153HD1_ORYSJ; Zinc finger protein HD1
TrEMBLC5Z8J70.0C5Z8J7_SORBI; Putative uncharacterized protein Sb10g010050
STRINGSb10g010050.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56223140
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.12e-62CONSTANS-like 2